PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.008G020600.1.p
Common NameSb08g001820, SORBIDRAFT_08g001820
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 320aa    MW: 35454.7 Da    PI: 7.5881
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.008G020600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.45.9e-171663148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT+eEd+ lv +++++G g+W+++++  g+ R+ k+c++rw +yl
  Sobic.008G020600.1.p 16 KGPWTPEEDLTLVSYIHEHGAGRWRLVPASTGLLRCSKSCRLRWTNYL 63
                          79******************************99************97 PP

2Myb_DNA-binding461.2e-1469114148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           rg++++ E+  +v++  +lG++ W++Ia++++  Rt++++k++w+++l
  Sobic.008G020600.1.p  69 RGNFSPREERVIVHLQSLLGNR-WAAIASHLP-QRTDNDIKNYWNTHL 114
                           89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.5E-22766IPR009057Homeodomain-like
PROSITE profilePS5129423.9811167IPR017930Myb domain
SuperFamilySSF466894.4E-2913110IPR009057Homeodomain-like
SMARTSM007171.1E-131565IPR001005SANT/Myb domain
PfamPF002494.9E-161663IPR001005SANT/Myb domain
CDDcd001671.90E-111863No hitNo description
Gene3DG3DSA:1.10.10.604.5E-2467118IPR009057Homeodomain-like
SMARTSM007175.2E-1468116IPR001005SANT/Myb domain
PROSITE profilePS5129419.45468118IPR017930Myb domain
PfamPF002493.6E-1369114IPR001005SANT/Myb domain
CDDcd001673.20E-1071113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MGRPPWCECD KAGIKKGPWT PEEDLTLVSY IHEHGAGRWR LVPASTGLLR CSKSCRLRWT  60
NYLRPGIRRG NFSPREERVI VHLQSLLGNR WAAIASHLPQ RTDNDIKNYW NTHLKKKLQE  120
EKEKQQAAIF AAAGHVDDDR RHRRHDVTAS SPLSKDDGSY GYARPAACSS STAADEVTQL  180
LIARRHSSSS SSSYPSSMDN ISKLLKGFLK SSPPPAQDDD AADSKLKPSA IDDDVVVHPF  240
VTFDHMSGTT GSALPPISDV ASTAPPQQVL TTGHGCFHDE AQQQQQQLSS IENWLFDEPN  300
KQQRMENSDG CCSLLPMLF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-24161187108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7283081e-113KJ728308.1 Zea mays clone pUT6588 MYB transcription factor (MYB69) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002441753.10.0hypothetical protein SORBIDRAFT_08g001820
TrEMBLC5YQS00.0C5YQS0_SORBI; Putative uncharacterized protein Sb08g001820
STRINGSb08g001820.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.11e-65myb domain protein 60